PDB entry 5qci

View 5qci on RCSB PDB site
Description: Crystal structure of human Cathepsin-S with bound ligand
Class: hydrolase
Keywords: D3R, Cathepsin S, Ligand Docking, HYDROLASE
Deposited on 2017-08-17, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (0-217)
      • engineered mutation (25)
      • expression tag (218-222)
    Domains in SCOPe 2.07: d5qcia1, d5qcia2
  • Heterogens: SO4, GOL, BJV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5qciA (A:)
    ilpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcste
    kygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpyg
    redvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkey
    wlvknswghnfgeegyirmarnkgnhcgiasfpsypeilqggg