PDB entry 5qbh

View 5qbh on RCSB PDB site
Description: Crystal structure of Endothiapepsin-FRG270 complex
Class: hydrolase
Keywords: Hydrolase
Deposited on 2017-08-04, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endothiapepsin
    Species: CRYPHONECTRIA PARASITICA [TaxId:5116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5qbha_
  • Heterogens: GOL, D8M, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5qbhA (A:)
    stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
    psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
    tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
    gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
    gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
    ginifgdvalkaafvvfngattptlgfask