PDB entry 5pnt

View 5pnt on RCSB PDB site
Description: crystal structure of a human low molecular weight phosphotyrosyl phosphatase. implications for substrate specificity
Class: hydrolase
Keywords: hydrolase, acetylation, tyrosine phosphatase
Deposited on 1998-04-29, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low molecular weight phosphotyrosyl phosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5pnta_
  • Heterogens: MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5pntA (A:)
aeqatksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgq
scmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
pqkqliiedpyygndsdfetvyqqcvrccraflekah