PDB entry 5pnt

View 5pnt on RCSB PDB site
Description: crystal structure of a human low molecular weight phosphotyrosyl phosphatase. implications for substrate specificity
Deposited on 1998-04-29, released 1998-10-14
The last revision prior to the SCOP 1.57 freeze date was dated 1998-10-14, with a file datestamp of 1998-10-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d5pnt__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5pnt_ (-)
  aeqatksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgq
  scmkrhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsyd
  pqkqliiedpyygndsdfetvyqqcvrccraflekah