PDB entry 5ph7

View 5ph7 on RCSB PDB site
Description: PanDDA analysis group deposition -- Crystal Structure of JMJD2D in complex with N09504a
Class: oxidoreductase
Keywords: PanDDA, SGC - Diamond I04-1 fragment screening, Jmj domain, epigenetics, OXIDOREDUCTASE
Deposited on 2017-02-07, released 2017-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: KDM4D, JHDM3D, JMJD2D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ph7a_
  • Heterogens: ZN, NI, OGA, EDO, SO4, 72V, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ph7A (A:)
    mhhhhhhssgvdlgtenlyfqsmetmkskancaqnpncnimifhptkeefndfdkyiaym
    esqgahraglakiippkewkaretydniseiliatplqqvasgragvftqyhkkkkamtv
    geyrhlanskkyqtpphqnfedlerkywknriynspiygadisgslfdentkqwnlghlg
    tiqdllekecgvviegvntpylyfgmwkttfawhtedmdlysinylhlgepktwyvvppe
    hgqrlerlarelfpgssrgcgaflrhkvalisptvlkengipfnritqeagefmvtfpyg
    yhagfnhgfncaeainfatprwidygkmasqcscgearvtfsmdafvrilqperydlwkr
    gqdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ph7A (A:)
    aqnpncnimifhptkeefndfdkyiaymesqgahraglakiippkewkaretydniseil
    iatplqqvasgragvftqyhkkkkamtvgeyrhlanskkyqtpphqnfedlerkywknri
    ynspiygadisgslfdentkqwnlghlgtiqdllekecgvviegvntpylyfgmwkttfa
    whtedmdlysinylhlgepktwyvvppehgqrlerlarelfpgssrgcgaflrhkvalis
    ptvlkengipfnritqeagefmvtfpygyhagfnhgfncaeainfatprwidygkmasqc
    scgearvtfsmdafvrilqperydlwkrg