PDB entry 5pgm

View 5pgm on RCSB PDB site
Description: saccharomyces cerevisiae phosphoglycerate mutase
Deposited on 1998-08-19, released 1999-02-16
The last revision prior to the SCOP 1.59 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.196
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d5pgma_
  • Chain 'B':
    Domains in SCOP 1.59: d5pgmb_
  • Chain 'C':
    Domains in SCOP 1.59: d5pgmc_
  • Chain 'D':
    Domains in SCOP 1.59: d5pgmd_
  • Chain 'E':
    Domains in SCOP 1.59: d5pgme_
  • Chain 'F':
    Domains in SCOP 1.59: d5pgmf_
  • Chain 'G':
    Domains in SCOP 1.59: d5pgmg_
  • Chain 'H':
    Domains in SCOP 1.59: d5pgmh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmA (A:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmB (B:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmC (C:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmD (D:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmE (E:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmF (F:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmG (G:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5pgmH (H:)
    pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
    iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
    ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
    hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa