PDB entry 5paz

View 5paz on RCSB PDB site
Description: reduced mutant p80a pseudoazurin from a. faecalis
Deposited on 1997-02-21, released 1997-08-20
The last revision prior to the SCOP 1.59 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d5paz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5paz_ (-)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctahyamgmialiavgdspanldqivsakkpkivqerlekvia
sak