PDB entry 5pal

View 5pal on RCSB PDB site
Description: crystal structure of the unique parvalbumin component from muscle of the leopard shark (triakis semifasciata). the first x-ray study of an alpha-parvalbumin
Class: calcium-binding protein
Keywords: calcium-binding protein
Deposited on 1991-09-25, released 1993-10-31
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.173
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin
    Species: Triakis semifasciata [TaxId:30493]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d5pala_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5palA (A:)
    pmtkvlkaddinkaisafkdpgtfdykrffhlvglkgktdaqvkevfeildkdqsgfiee
    eelkgvlkgfsahgrdlndtetkallaagdsdhdgkigadefakmvaqa