PDB entry 5p2p

View 5p2p on RCSB PDB site
Description: x-ray structure of phospholipase a2 complexed with a substrate-derived inhibitor
Class: hydrolase(carboxylic ester)
Keywords: hydrolase(carboxylic ester)
Deposited on 1990-09-01, released 1991-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: Sus scrofa
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-118)
    • conflict (2)
    • conflict (30)
    • conflict (58-59)
    • conflict (61)
  Domains in SCOP 1.75: d5p2pa_
• Chain 'B':
  Compound: phospholipase a2
  Species: Sus scrofa
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00592 (0-118)
    • conflict (2)
    • conflict (30)
    • conflict (58-59)
    • conflict (61)
  Domains in SCOP 1.75: d5p2pb_
• Heterogens: CA, DHG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5p2pA (A:)
  alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
  cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5p2pB (B:)
  alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
  cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc