PDB entry 5p2p

View 5p2p on RCSB PDB site
Description: x-ray structure of phospholipase a2 complexed with a substrate-derived inhibitor
Class: hydrolase(carboxylic ester)
Keywords: hydrolase(carboxylic ester)
Deposited on 1990-09-01, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-118)
      • conflict (2)
      • conflict (30)
      • conflict (58-59)
      • conflict (61)
    Domains in SCOPe 2.08: d5p2pa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00592 (0-118)
      • conflict (2)
      • conflict (30)
      • conflict (58-59)
      • conflict (61)
    Domains in SCOPe 2.08: d5p2pb_
  • Heterogens: CA, DHG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5p2pA (A:)
    alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
    cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5p2pB (B:)
    alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
    cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc