PDB entry 5p2p
View 5p2p on RCSB PDB site
Description: x-ray structure of phospholipase a2 complexed with a substrate-derived inhibitor
Class: hydrolase(carboxylic ester)
Keywords: hydrolase(carboxylic ester)
Deposited on
1990-09-01, released
1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
- Uniprot P00592 (0-118)
- conflict (2)
- conflict (30)
- conflict (58-59)
- conflict (61)
Domains in SCOPe 2.08: d5p2pa_ - Chain 'B':
Compound: phospholipase a2
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
- Uniprot P00592 (0-118)
- conflict (2)
- conflict (30)
- conflict (58-59)
- conflict (61)
Domains in SCOPe 2.08: d5p2pb_ - Heterogens: CA, DHG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5p2pA (A:)
alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5p2pB (B:)
alfqfrsmikcaipgshplmdfnnygcycgwggsgtpvdeldrccethdncyrdaknlsg
cypytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldtkkyc