PDB entry 5oyh

View 5oyh on RCSB PDB site
Description: crystal structure of the catalytic core of a rhodopsin-guanylyl cyclase with converted specificity in complex with ATPalphaS
Class: lyase
Keywords: Nucleotide Cyclase, Inhibitor, LYASE
Deposited on 2017-09-09, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-End)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyha_
  • Chain 'B':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhb_
  • Chain 'C':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhc_
  • Chain 'D':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhd_
  • Chain 'E':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhe_
  • Chain 'F':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhf_
  • Chain 'G':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhg_
  • Chain 'H':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhh_
  • Chain 'I':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhi_
  • Chain 'J':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhj_
  • Chain 'K':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-End)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhk_
  • Chain 'L':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhl_
  • Chain 'M':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhm_
  • Chain 'N':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • initiating methionine (0)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhn_
  • Chain 'O':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (Start-184)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyho_
  • Chain 'P':
    Compound: Nucleotide cyclase
    Species: Catenaria anguillulae PL171 [TaxId:765915]
    Gene: BCR44DRAFT_1480233
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A1Y2HEJ3 (1-184)
      • engineered mutation (55)
      • engineered mutation (124)
    Domains in SCOPe 2.08: d5oyhp_
  • Heterogens: T99, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oyhA (A:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhA (A:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oyhB (B:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhB (B:)
    teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigda
    ylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdln
    phwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywv
    tark
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oyhC (C:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhC (C:)
    teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigda
    ylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdln
    phwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywv
    tark
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oyhD (D:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhD (D:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtark
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5oyhE (E:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhE (E:)
    eakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigday
    lgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdlnp
    hwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvt
    ar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5oyhF (F:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhF (F:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtark
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5oyhG (G:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhG (G:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtark
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5oyhH (H:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhH (H:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtark
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5oyhI (I:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhI (I:)
    eakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigday
    lgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdlnp
    hwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvt
    ar
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5oyhJ (J:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhJ (J:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtark
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5oyhK (K:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhK (K:)
    teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigda
    ylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdln
    phwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywv
    tar
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5oyhL (L:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhL (L:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtark
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5oyhM (M:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhM (M:)
    teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigda
    ylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlphwd
    lvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvtark
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5oyhN (N:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhN (N:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlphw
    dlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvtar
    k
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5oyhO (O:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhO (O:)
    eakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigday
    lgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlphwdl
    vgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvtark
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5oyhP (P:)
    mteakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigd
    aylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvlgdl
    nphwdlvgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtyw
    vtarklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oyhP (P:)
    teakeyesvtvffsditnftvissrtstkdmmatlnklwleydaiakrwgvykvktigda
    ylgvtgapevvpdhadravnfaldiiemiktfktatgesiniriglnsgpvtagvphwdl
    vgdtvntasrmestskaghihisdstyqmikgkfvtqpldlmevkgkgkmqtywvtark