PDB entry 5oy0

View 5oy0 on RCSB PDB site
Description: Structure of synechocystis photosystem I trimer at 2.5A resolution
Class: photosynthesis
Keywords: photosystem I, reaction center, photosynthesis, cyanobacteria, electron transfer chain, synechocystis
Deposited on 2017-09-07, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: Photosystem I reaction center subunit XI
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy00_
  • Chain '1':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy01_
  • Chain '2':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy02_
  • Chain '3':
    Compound: photosystem I iron-sulfur center
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy03_
  • Chain '4':
    Compound: Photosystem I reaction center subunit II
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy04_
  • Chain '5':
    Compound: photosystem I reaction center subunit IV
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy05_
  • Chain '6':
    Compound: Photosystem I reaction center subunit III
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy06_
  • Chain '7':
    Compound: Photosystem I reaction center subunit IX
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy07_
  • Chain '8':
    Compound: Photosystem I reaction center subunit PsaK 2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy08_
  • Chain '9':
    Compound: Photosystem I reaction center subunit XII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'A':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0a_
  • Chain 'B':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: photosystem I iron-sulfur center
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Photosystem I reaction center subunit II
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0d_
  • Chain 'E':
    Compound: photosystem I reaction center subunit IV
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Photosystem I reaction center subunit III
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0f_
  • Chain 'I':
    Compound: Photosystem I reaction center subunit VIII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0i_
  • Chain 'J':
    Compound: Photosystem I reaction center subunit IX
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0j_
  • Chain 'K':
    Compound: Photosystem I reaction center subunit PsaK 2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Photosystem I reaction center subunit XI
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0l_
  • Chain 'M':
    Compound: Photosystem I reaction center subunit XII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'a':
    Compound: photosystem I p700 chlorophyll a apoprotein a1
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'b':
    Compound: photosystem I p700 chlorophyll a apoprotein a2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0b_
  • Chain 'c':
    Compound: photosystem I iron-sulfur center
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0c_
  • Chain 'd':
    Compound: Photosystem I reaction center subunit II
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'e':
    Compound: photosystem I reaction center subunit IV
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0e_
  • Chain 'f':
    Compound: Photosystem I reaction center subunit III
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'h':
    Compound: Photosystem I reaction center subunit VIII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0h_
  • Chain 'i':
    Compound: Photosystem I reaction center subunit VIII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'j':
    Compound: Photosystem I reaction center subunit IX
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'k':
    Compound: Photosystem I reaction center subunit PsaK 2
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oy0k_
  • Chain 'l':
    Compound: Photosystem I reaction center subunit XI
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Chain 'm':
    Compound: Photosystem I reaction center subunit XII
    Species: Synechocystis sp. (strain PCC 6803 / Kazusa) [TaxId:1111708]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CLA, PQN, SF4, BCR, LHG, LMG, ACT, 45D, CL, ECH, SQD, CA, MG, C7Z, LMT, EQ3, DGD, HOH

PDB Chain Sequences:

  • Chain '0':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy00 (0:)
    snqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyflig
    pwtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgwsqf
    aagffvggmggafvayfllenlsvvdgifrglfn
    

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy01 (1:)
    reakakvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfdsqtsdled
    vsrkifsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpivgqgiln
    gdvgggfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhyhvkapkl
    ewfqnvesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplphefileps
    kmaelypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlaiavlfiia
    ghmyrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallgsltiiva
    qhmyamppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpaknvnnlld
    rmlrhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqpifaqwvq
    hlhtlapgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaftihvtal
    illkgvlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmynslsivif
    hfswkmqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvinsygsalsa
    ygimflaghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsiiqgravg
    vahyllggivttwafflarslsig
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy02 (2:)
    matkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflw
    tsgtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgv
    yhwfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhla
    glfgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdta
    ghifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighs
    ikeilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafia
    qdhttqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishl
    swvslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpd
    siasttgaawlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgaldarg
    sklmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhlgvws
    gnvaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwatgfmf
    liswrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvltyaa
    fliastagkfg
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy03 (3:)
    shsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacptd
    flsirvylgaettrsmglay
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy04 (4:)
    telsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllylar
    keqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktrr
    igqnpepvtikfsgkapyev
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy05 (5:)
    alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
    aenelelvq
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy06 (6:)
    addfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrft
    hagdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwpl
    aavgeytsgklvmkdseiptspr
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy07 (7:)
    mdglksflstapvmimalltftagiliefnrfypdllfhp
    

  • Chain '8':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy08 (8:)
    aqaspttagwslsvgiimclcnvfafvigyfaiqktgkgkdlalpqlaskktfglpella
    tmsfghilgagmvlglass
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0A (A:)
    mtisppereakakvsvdnnpvptsfekwgkpghfdrtlargpktttwiwnlhanahdfds
    qtsdledvsrkifsahfghlavvfvwlsgmyfhgakfsnyegwladpthikpsaqvvwpi
    vgqgilngdvgggfhgiqitsglfylwrasgftdsyqlyctaigglvmaalmlfagwfhy
    hvkapklewfqnvesmmnhhlagllglgslgwaghqihvsmpinklldagvapkdiplph
    efilepskmaelypsfaqgltpfftlnwgvysdfltfkgglnpvtgglwlsdtahhhlai
    avlfiiaghmyrtnwgighsmkeileahkgpftgeghkglyeilttswhaqlainlallg
    sltiivaqhmyamppypyqaidyatqlslfthhmwiggflivgagahgaifmvrdydpak
    nvnnlldrmlrhrdaiishlnwvciflgfhsfglyihndtmralgrpqdmfsdtaiqlqp
    ifaqwvqhlhtlapgatapnalatasyafggetiavagkvammpitlgtadfmvhhihaf
    tihvtalillkgvlyarssrlvpdkanlgfrfpcdgpgrggtcqvsgwdhvflglfwmyn
    slsivifhfswkmqsdvwgtvspdgsvthvtlgnfaqsaitingwlrdflwaqaanvins
    ygsalsaygimflaghfvfafslmflfsgrgywqeliesivwahnklnvapaiqpralsi
    iqgravgvahyllggivttwafflarslsig
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0D (D:)
    mtelsgqppkfggstggllskanreekyaitwtsaseqvfemptggaaimnegenllyla
    rkeqclalgtqlrtkfkpkiqdykiyrvypsgevqylhpadgvfpekvnegreaqgtktr
    rigqnpepvtikfsgkapyev
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0F (F:)
    addfanltpcsenpaylaksknflnttndpnsgkiraeryasalcgpegyphlivdgrft
    hagdflipsilflyiagwigwvgrsylieiresknpemqevvinvplaikkmlggflwpl
    aavgeytsgklvmkdseiptspr
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0I (I:)
    mdgsyaasylpwilipmvgwlfpavtmgllfihiesegeg
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0J (J:)
    mdglksflstapvmimalltftagiliefnrfypdllfhp
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0L (L:)
    maesnqvvqayngdpfvghlstpisdsaftrtfignlpayrkglspilrglevgmahgyf
    ligpwtllgplrdseyqyiggligalalilvataalssyglvtfqgeqgsgdtlqtadgw
    sqfaagffvggmggafvayfllenlsvvdgifrglfn
    

  • Chain 'M':
    No sequence available.

  • Chain 'a':
    No sequence available.

  • Chain 'b':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0b (b:)
    tkfpkfsqdlaqdpttrriwygiatahdfethdgmteenlyqkifashfghiaiiflwts
    gtlfhvawqgnfeqwikdplnirpiahaiwdphfgegavnaftqagasnpvniaysgvyh
    wfytigmttnqelysgavfllvlaslflfagwlhlqpkfrpslawfknaesrlnhhlagl
    fgvsslawaghlvhvaipeargqhvgwdnflstpphpaglmpfftgnwgvyaadpdtagh
    ifgtsegagtailtflggfhpqteslwltdiahhhlaiavifiiaghmyrtnwgighsik
    eilnahkgpltgaghtnlydtinnslhfqlglalaslgvitslvaqhmyslpsyafiaqd
    httqaalythhqyiagflmvgafahgaiffvrdydpvankdnvlarmlehkealishlsw
    vslflgfhtlglyvhndvvvafgtpekqiliepvfaqwiqatsgkalygfdvllsnpdsi
    asttgaawlpgwldainsgtnslfltigpgdflvhhaialglhttalilikgaldargsk
    lmpdkkdfgysfpcdgpgrggtcdisawdafylamfwmlntlgwltfywhwkhlgvwsgn
    vaqfnenstylmgwfrdylwansaqlingynpygvnnlsvwawmflfghlvwatgfmfli
    swrgywqelietivwahertplanlvrwkdkpvalsivqarlvglahftvgyvltyaafl
    iastagkfg
    

  • Chain 'c':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0c (c:)
    mshsvkiydtcigctqcvracpldvlemvpwdgckaaqiassprtedcvgckrcetacpt
    dflsirvylgaettrsmglay
    

  • Chain 'd':
    No sequence available.

  • Chain 'e':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0e (e:)
    alnrgdkvrikrtesywygdvgtvasveksgilypvivrfdrvnyngfsgsasgvntnnf
    aenelelv
    

  • Chain 'f':
    No sequence available.

  • Chain 'h':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0h (h:)
    mdgsyaasylpwilipmvgwlfpavtmgllfihieseg
    

  • Chain 'i':
    No sequence available.

  • Chain 'j':
    No sequence available.

  • Chain 'k':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oy0k (k:)
    aqaspttagwslsvgiimclcnvfafvigyfaiqktgkgkdlalpqlaskktfglpella
    tmsfghilgagmvlglas
    

  • Chain 'l':
    No sequence available.

  • Chain 'm':
    No sequence available.