PDB entry 5oxi

View 5oxi on RCSB PDB site
Description: C-terminally retracted ubiquitin L67S mutant
Class: signaling protein
Keywords: ubiquitin, post-translational modifier, signaling protein
Deposited on 2017-09-06, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin L67S mutant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-End)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5oxia_
  • Chain 'B':
    Compound: Ubiquitin L67S mutant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-75)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d5oxib_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oxiA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestshlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oxiA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestshlvlrlrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oxiB (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestshlvlrlrgg