PDB entry 5oxh

View 5oxh on RCSB PDB site
Description: C-terminally retracted ubiquitin T66V/L67N mutant
Class: signaling protein
Keywords: ubiquitin, post-translational modifier, signaling protein
Deposited on 2017-09-06, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin T66V/L67N mutant
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (0-75)
      • engineered mutation (65-66)
    Domains in SCOPe 2.07: d5oxha_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oxhA (A:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkesvnhlvlrlrgg