PDB entry 5owf

View 5owf on RCSB PDB site
Description: Structure of a LAO-binding protein mutant with glutamine
Class: transport protein
Keywords: ligand specificity, protein design, binding pocket, periplasmatic binding protein, TRANSPORT PROTEIN
Deposited on 2017-08-31, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histidine ABC transporter substrate-binding protein HisJ
    Species: Salmonella choleraesuis [TaxId:28901]
    Gene: A7S24_15005, A7S72_12890, IN36_00825, IN69_11895, IN77_04515, IN95_02550
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M0PVY4 (Start-258)
      • engineered mutation (137)
    Domains in SCOPe 2.07: d5owfa_
  • Heterogens: GLN, EDO, PEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5owfA (A:)
    mgsshhhhhhssglvprgshmalpqtvrigtdttyapfsskdakgefigfdidlgnemck
    rmqvkctwvasdfdalipslkakkidaiisslsitdkrqqeiafsdklyaadsrliaakg
    spiqptleslkgkhvgvkqgstqeayandnwrtkgvdvvayanqdliysdltagrldaal
    qdevaasegflkqpagkeyafagpsvkdkkyfgdgtgvglrkddtelkaafdkaltelrq
    dgtydkmakkyfdfnvygd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5owfA (A:)
    qtvrigtdttyapfsskdakgefigfdidlgnemckrmqvkctwvasdfdalipslkakk
    idaiisslsitdkrqqeiafsdklyaadsrliaakgspiqptleslkgkhvgvkqgstqe
    ayandnwrtkgvdvvayanqdliysdltagrldaalqdevaasegflkqpagkeyafagp
    svkdkkyfgdgtgvglrkddtelkaafdkaltelrqdgtydkmakkyfdfnvygd