PDB entry 5owc

View 5owc on RCSB PDB site
Description: Indole-2 carboxamides as selective secreted phospholipase A2 type X (sPLA2-X) inhibitors
Class: lipid binding protein
Keywords: Inhibitor, secreted, phospholipase, LIPID BINDING PROTEIN
Deposited on 2017-08-31, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: group 10 secretory phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5owca_
  • Chain 'B':
    Compound: group 10 secretory phospholipase a2
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2G10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5owcb_
  • Heterogens: AYZ, CA, DMS, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5owcA (A:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5owcB (B:)
    gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp
    kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp
    kc