PDB entry 5owa

View 5owa on RCSB PDB site
Description: Crystal structure of the human BRPF1 bromodomain in complex with BZ054
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1(BRPF1), monocytic leukemia zinc-finger (MOZ), Inhibitor, transcription, DNA binding protein
Deposited on 2017-08-31, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5owaa_
  • Chain 'B':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5owab_
  • Chain 'C':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5owac_
  • Chain 'D':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BRPF1, BR140
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5owad_
  • Heterogens: B0H, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5owaA (A:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5owaA (A:)
    ltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayryln
    fddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5owaB (B:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5owaB (B:)
    qltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayryl
    nfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5owaC (C:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5owaC (C:)
    memqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleay
    rylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5owaD (D:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5owaD (D:)
    ltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayryln
    fddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm