PDB entry 5ovo

View 5ovo on RCSB PDB site
Description: Structure of DraG-GlnZ-delta42-54 complex from Azospirillum brasilense
Class: metal binding protein
Keywords: Glycohydrolase, METAL BINDING PROTEIN
Deposited on 2017-08-29, released 2017-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosyl-(Dinitrogen reductase) hydrolase
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Gene: draG, AMK58_04675
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ovoa_
  • Chain 'B':
    Compound: Nitrogen regulatory protein P-II 1
    Species: AZOSPIRILLUM BRASILENSE [TaxId:192]
    Gene: glnZ, ABAZ39_13575, AMK58_13670
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ovob_
  • Heterogens: ADP, MG, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ovoA (A:)
    mtdhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtd
    dtemsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepes
    eyhagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlg
    gdvrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnq
    ggdadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovoA (A:)
    dhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddt
    emsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepesey
    hagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggd
    vrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqgg
    dadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ovoB (B:)
    mklvmaiikpfkldevrealtslgiqgltvsevkgfgrqkgflpkvkvevavsddqyeqv
    veaiqkaantgrigdgkifvldiaqavrirtgetnteal