PDB entry 5ovf

View 5ovf on RCSB PDB site
Description: Ras guanine nucleotide exchange factor SOS1 (Rem-cdc25) in complex with small molecule inhibitor compound 17
Class: signaling protein
Keywords: SIGNALING PROTEIN, Guanine exchange factor, GEF, inhibitor, SOS1
Deposited on 2017-08-28, released 2019-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Son of sevenless homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SOS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07889 (0-End)
      • engineered mutation (0-3)
    Domains in SCOPe 2.08: d5ovfa_
  • Heterogens: AWT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ovfA (A:)
    gamaeeqmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmya
    dpnfvrtflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrk
    eyiqpvqlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqr
    kkiardngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyrav
    qpselvgsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieil
    qvfqelnnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylakl
    rsinppcvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpy
    clrvesdikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspg
    vrpsnprpgt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovfA (A:)
    gamaeeqmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvr
    tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
    qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
    fqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtked
    keinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvle
    vvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiy
    ltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffen
    lnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp