PDB entry 5ova

View 5ova on RCSB PDB site
Description: Apo PDZ domain from rat Shank3
Class: protein binding
Keywords: PDZ domain, peptide binding, post-synaptic density, PROTEIN BINDING
Deposited on 2017-08-28, released 2018-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 and multiple ankyrin repeat domains protein 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank3, Prosap2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-95)
      • expression tag (0)
    Domains in SCOPe 2.08: d5ovaa1, d5ovaa2
  • Chain 'B':
    Compound: SH3 and multiple ankyrin repeat domains protein 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Shank3, Prosap2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLU4 (1-95)
      • expression tag (0)
    Domains in SCOPe 2.08: d5ovab1, d5ovab2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ovaA (A:)
    svailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawkaglrtgdf
    lievngvnvvkvghkqvvglirqggnrlvmkvvsvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovaA (A:)
    svailqkrdhegfgfvlrgapieeftptpafpalqylesvdvegvawkaglrtgdfliev
    ngvnvvkvghkqvvglirqggnrlvmkvvsvt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ovaB (B:)
    svailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawkaglrtgdf
    lievngvnvvkvghkqvvglirqggnrlvmkvvsvt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ovaB (B:)
    svailqkrdhegfgfvlrgpieeftptpafpalqylesvdvegvawkaglrtgdflievn
    gvnvvkvghkqvvglirqggnrlvmkvvsvt