PDB entry 5ouw

View 5ouw on RCSB PDB site
Description: Metal free structure of SynFtn
Class: metal binding protein
Keywords: Ferritin, METAL BINDING PROTEIN
Deposited on 2017-08-25, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Synechococcus sp. (strain CC9311) [TaxId:64471]
    Gene: sync_1539
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ouwa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ouwA (A:)
    vaqgpngralaesmnpdllsaiqqhisieryasvtylamsiwcaerelagfyqffdgeak
    deqshavhftqyliarsqsndlqtldaprqnwdslaslmatafqmeadttssiqsvyala
    ernsdtrttvfldplieaqiqsedqfayllgrvkfangdptallvidnelragqtqr