PDB entry 5oui

View 5oui on RCSB PDB site
Description: Humanized alpha-AChBP (acetylcholine binding protein) in complex with allosteric binder fragment CU2017
Class: choline-binding protein
Keywords: acetylcholine binding protein, nicotinic acetylcholine receptor, CHOLINE-BINDING PROTEIN
Deposited on 2017-08-23, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUI (0-204)
    Domains in SCOPe 2.07: d5ouia_
  • Chain 'B':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUI (0-204)
    Domains in SCOPe 2.07: d5ouib_
  • Chain 'C':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUI (0-204)
    Domains in SCOPe 2.07: d5ouic_
  • Chain 'D':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUI (0-204)
    Domains in SCOPe 2.07: d5ouid_
  • Chain 'E':
    Compound: acetylcholine binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUI (0-204)
    Domains in SCOPe 2.07: d5ouie_
  • Heterogens: NAG, BMA, MAN, AVB, EDO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ouiA (A:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ouiB (B:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ouiC (C:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ouiD (D:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ouiE (E:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg