PDB entry 5oug

View 5oug on RCSB PDB site
Description: Humanized alpha-AChBP (acetylcholine binding protein) in complex with lobeline and allosteric binder fragment 4.
Class: choline-binding protein
Keywords: acetylcholine binding protein, nicotinic acetylcholine receptor, CHOLINE-BINDING PROTEIN
Deposited on 2017-08-23, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Humanized alpha-AChBP
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA7, NACHRA7
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUG (0-204)
    Domains in SCOPe 2.07: d5ouga_
  • Chain 'B':
    Compound: Humanized alpha-AChBP
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA7, NACHRA7
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUG (0-204)
    Domains in SCOPe 2.07: d5ougb_
  • Chain 'C':
    Compound: Humanized alpha-AChBP
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA7, NACHRA7
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUG (0-204)
    Domains in SCOPe 2.07: d5ougc_
  • Chain 'D':
    Compound: Humanized alpha-AChBP
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA7, NACHRA7
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUG (0-204)
    Domains in SCOPe 2.07: d5ougd_
  • Chain 'E':
    Compound: Humanized alpha-AChBP
    Species: Homo sapiens [TaxId:9606]
    Gene: CHRNA7, NACHRA7
    Database cross-references and differences (RAF-indexed):
    • PDB 5OUG (0-204)
    Domains in SCOPe 2.07: d5ouge_
  • Heterogens: L0B, NAG, 9Z0, BMA, MAN, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ougA (A:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ougB (B:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ougC (C:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ougD (D:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ougE (E:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvviwlqmswt
    dhylqwnvseypgvkqvsvpisslwkpdillynaierpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg