PDB entry 5ou3

View 5ou3 on RCSB PDB site
Description: M. thermoresistible IMPDH in complex with IMP and Compound 31 (AT080)
Class: oxidoreductase
Keywords: Complex, Fragment, IMPDH, OXIDOREDUCTASE
Deposited on 2017-08-23, released 2018-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase
    Species: Mycobacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) [TaxId:1078020]
    Gene: guaB, KEK_23061
    Database cross-references and differences (RAF-indexed):
    • Uniprot G7CNL4 (Start-109)
      • linker (110-111)
    • Uniprot G7CNL4 (112-End)
    Domains in SCOPe 2.07: d5ou3a_
  • Heterogens: AUN, IMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ou3A (A:)
    gssiaersvpiavpvptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkir
    lkvplvssamdtvtearmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavg
    vgddaweramalrdagvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaa
    aalveagadavkvgvgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqys
    gdiakalaagastamlgsllagtaespgelilvngkqfksyrgmgslgamqgrggaksys
    kdryfqddalsedklvpegiegrvpfrgplstvihqlvgglraamgytgsatieelqqaq
    fvqitaaglkeshphditmtveapnyyar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ou3A (A:)
    pvptggddptkiamlgltfddvlllpaasdvlpanadtssqltkkirlkvplvssamdtv
    tearmaiamaraggmgvlhrnlpvaeqaaqvetvkrsggllvgaavgvgddaweramalr
    dagvdvlvvdtahahnrkvldmvhrlkttvgdeievvggnvatraaaaalveagadavkv
    gvgpgsicttrvvagvgapqitaileavaacaphgvpviadgglqysgdiakalaagast
    amlgsllagtaespgelilvngkqfksyrgmgslgamqglvpegiegrvpfrgplstvih
    qlvgglraamgytgsatieelqqaqfvqitaagl