PDB entry 5otb

View 5otb on RCSB PDB site
Description: Structure of caprine serum albumin in P1 space group
Class: transport protein
Keywords: caprine serum albumin, goat serum albumin, P1, TRANSPORT PROTEIN
Deposited on 2017-08-21, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Albumin
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5otba1, d5otba2, d5otba3
  • Chain 'B':
    Compound: Albumin
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5otbb1, d5otbb2, d5otbb3
  • Chain 'C':
    Compound: Albumin
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5otbc1, d5otbc2, d5otbc3
  • Chain 'D':
    Compound: Albumin
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5otbd1, d5otbd2, d5otbd3
  • Heterogens: PGE, PRO, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5otbA (A:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfllegpklvastqaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otbA (A:)
    hkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadeshagc
    dkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepdtl
    caefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
    tmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhk
    ecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpenlp
    pltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccak
    edphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstptl
    veisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkccteslvn
    rrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatdeq
    lktvmenfvafvdkccaaddkegcfllegpklvastqaala
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5otbB (B:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfllegpklvastqaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otbB (B:)
    hkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadeshagc
    dkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepdtl
    caefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
    tmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhk
    ecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpenlp
    pltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccak
    edphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstptl
    veisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkccteslvn
    rrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatdeq
    lktvmenfvafvdkccaaddkegcfllegpklvastqaala
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5otbC (C:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfllegpklvastqaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otbC (C:)
    hkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadeshagc
    dkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepdtl
    caefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
    tmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhk
    ecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpenlp
    pltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccak
    edphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstptl
    veisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkccteslvn
    rrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatdeq
    lktvmenfvafvdkccaaddkegcfllegpklvastqaala
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5otbD (D:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfllegpklvastqaala
    

    Sequence, based on observed residues (ATOM records): (download)
    >5otbD (D:)
    hkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadeshagc
    dkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepdtl
    caefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
    tmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhk
    ecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpenlp
    pltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccak
    edphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstptl
    veisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkccteslvn
    rrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatdeq
    lktvmenfvafvdkccaaddkegcfllegpklvastqaala