PDB entry 5osy

View 5osy on RCSB PDB site
Description: Human Decapping Scavenger enzyme (hDcpS) in complex with m7G(5'S)ppSp(5'S)G mRNA 5' cap analog
Class: hydrolase
Keywords: Protein-ligand complex, decapping, DcpS, m7G(5'S)ppSp(5'S)G, phosphorothiolate, mRNA 5' cap analog, mRNA turnover, HYDROLASE
Deposited on 2017-08-18, released 2018-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m7GpppX diphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: DCPS, DCS1, HINT5, HSPC015
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C86 (0-End)
      • conflict (0)
    Domains in SCOPe 2.08: d5osya1, d5osya2
  • Chain 'B':
    Compound: m7GpppX diphosphatase
    Species: Homo sapiens [TaxId:9606]
    Gene: DCPS, DCS1, HINT5, HSPC015
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5osyb1, d5osyb2
  • Heterogens: AJQ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5osyA (A:)
    sapvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaq
    lltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgd
    dyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddl
    yliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhl
    hvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >5osyA (A:)
    sapvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaq
    lltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgd
    dyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddl
    yliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhl
    hvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5osyB (B:)
    sapvrlpfsgfrlqkvlresardkiiflhgkvneasgdgdgedavvilektpfqveqvaq
    lltgspelqlqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgd
    dyrnitlphlesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddl
    yliaichrrgirslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhl
    hvhftalgfeapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >5osyB (B:)
    vrlpfsgfrlqkvlresardkiiflhgkvnegedavvilektpfqveqvaqlltgspelq
    lqfsndiystyhlfpprqlndvkttvvypatekhlqkylrqdlrliretgddyrnitlph
    lesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdlkwnqqqlddlyliaichrr
    girslrdltpehlpllrnilhqgqeailqryrmkgdhlrvylhylpsyyhlhvhftalgf
    eapgsgverahllaevienlecdprhyqqrtltfalraddpllkllqeaqq