PDB entry 5osx

View 5osx on RCSB PDB site
Description: Translation initiation factor 4E in complex with m7G(5'S)ppp(5'S)G mRNA 5' cap analog
Class: translation
Keywords: Protein-ligand complex, translation initiation factor, eIF4E, m7G(5'S)ppp(5'S)G, phosphorothiolate, mRNA 5' cap analog, translation
Deposited on 2017-08-18, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5osxa_
  • Chain 'B':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5osxb_
  • Chain 'C':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: eukaryotic translation initiation factor 4e
    Species: Mus musculus [TaxId:10090]
    Gene: eif4e
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AKW, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5osxA (A:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5osxA (A:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtknrfvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5osxB (B:)
    vanpehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmp
    gcdyslfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysd
    dvcgavvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtatks
    gsttknrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5osxB (B:)
    ehyikhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenrdavthigrvykerlglppkivigyqshadtknrfvv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.