PDB entry 5osw

View 5osw on RCSB PDB site
Description: Structure of caprine serum albumin in complex with 3,5-diiodosalicylic acid
Class: transport protein
Keywords: caprine serum albumin, goat serum albumin, 3, 5-diiodosalicylic acid, DIU, orthorhombic crystal system, TRANSPORT PROTEIN
Deposited on 2017-08-18, released 2017-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Albumin
    Species: Capra hircus [TaxId:9925]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oswa1, d5oswa2, d5oswa3
  • Heterogens: DIU, CIT, JEF, AE4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5oswA (A:)
    dthkseiahrfndlgeenfqglvliafsqylqqcpfdehvklvkeltefaktcvadesha
    gcdkslhtlfgdelckvatlretygdmadccekqepernecflkhkddspdlpklkpepd
    tlcaefkadekkfwgkylyevarrhpyfyapellyyankyngvfqeccqaedkgacllpk
    ietmrekvlassarqrlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkv
    hkecchgdllecaddradlakyicdhqdtlssklkeccdkpvlekshciaeidkdavpen
    lppltadfaedkevcknyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledcc
    akedphacyatvfdklkhlvdepqnlikkncelfekhgeygfqnalivrytrkapqvstp
    tlveisrslgkvgtkccakpesermpctedylslilnrlcvlhektpvsekvtkcctesl
    vnrrpcfsdltldetyvpkpfdgesftfhadictlpdtekqikkqtalvellkhkpkatd
    eqlktvmenfvafvdkccaaddkegcfllegpklvastqaala