PDB entry 5os5

View 5os5 on RCSB PDB site
Description: Crystal structure of Aurora-A kinase in complex with an allosterically binding fragment
Class: transferase
Keywords: kinase, allosteric inhibitor, fragment, TRANSFERASE
Deposited on 2017-08-16, released 2017-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aurora kinase A
    Species: Homo sapiens [TaxId:9606]
    Gene: AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14965 (0-267)
      • conflict (165)
    Domains in SCOPe 2.06: d5os5a_
  • Heterogens: A8K, ADP, MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5os5A (A:)
    krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
    qshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanal
    sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlagtldylppemiegr
    mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
    khnpsqrpmlrevlehpwitansskpsn