PDB entry 5orb

View 5orb on RCSB PDB site
Description: Crystal Structure of BAZ2B bromodomain in complex with 1-methyl-cyclopentapyrazole compound 30
Class: transcription
Keywords: four helical bundle, transcription
Deposited on 2017-08-15, released 2017-09-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain adjacent to zinc finger domain protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: BAZ2B, KIAA1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UIF8 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d5orba1, d5orba2
  • Heterogens: JR6, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5orbA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkvs

    Sequence, based on observed residues (ATOM records): (download) 
    >5orbA (A:)
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv