PDB entry 5oqw

View 5oqw on RCSB PDB site
Description: XIAP in complex with small molecule
Class: apoptosis
Keywords: XIAP, Protease inhibitor, Apoptosis regulation, APOPTOSIS
Deposited on 2017-08-14, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oqwa_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase XIAP
    Species: Homo sapiens [TaxId:9606]
    Gene: XIAP, API3, BIRC4, IAP3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P98170 (21-126)
      • expression tag (20)
    Domains in SCOPe 2.07: d5oqwb1, d5oqwb2
  • Heterogens: ZN, NA, A4E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oqwA (A:)
    mgsshhhhhhssglvprgshmnfpnstnlprnpsmadyeariftfgtwiysvnkeqlara
    gfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlths
    leeclvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oqwA (A:)
    nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
    dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oqwB (B:)
    mgsshhhhhhssglvprgshmnfpnstnlprnpsmadyeariftfgtwiysvnkeqlara
    gfyalgegdkvkcfhcgggltdwkpsedpweqhakwypgckylleqkgqeyinnihlths
    leeclvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oqwB (B:)
    mnfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggl
    tdwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr