PDB entry 5oqe

View 5oqe on RCSB PDB site
Description: XFEL structure of the on state of a reversibly photoswitching fluorescent protein determined using the droplet injection method
Class: fluorescent protein
Keywords: XFEL photoswitching, FLUORESCENT PROTEIN
Deposited on 2017-08-11, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9 (0-End)
      • engineered mutation (9)
      • chromophore (60)
      • engineered mutation (66)
      • engineered mutation (70)
      • engineered mutation (98)
      • engineered mutation (117)
      • engineered mutation (119)
      • engineered mutation (153-154)
      • engineered mutation (185)
    Domains in SCOPe 2.06: d5oqea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oqeA (A:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    xnrvfakypdniqdyfkqsfpkgyswersltfedggicnarnditmegdtfynkvrfygt
    nfpangpvmqkktlkwepstekmyvrdgvltgdvemalllegnahyrcdfrttykakekg
    vklpgahfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oqeA (A:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    xnrvfakypdniqdyfkqsfpkgyswersltfedggicnarnditmegdtfynkvrfygt
    nfpangpvmqkktlkwepstekmyvrdgvltgdvemalllegnahyrcdfrttykakekg
    vklpgahfvdhcieilshdkdynkvklyehavahsgl