PDB entry 5oqa

View 5oqa on RCSB PDB site
Description: XFEL structure of the off state of a reversibly photoswitching fluorescent protein determined using the GDVN injection method
Class: fluorescent protein
Keywords: XFEL photoswitching, FLUORESCENT PROTEIN
Deposited on 2017-08-11, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Green to red photoconvertible GFP-like protein EosFP
    Species: Lobophyllia hemprichii [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5S6Z9
      • engineered mutation (10)
      • chromophore (61)
      • engineered mutation (67)
      • engineered mutation (71)
      • engineered mutation (118)
      • engineered mutation (120)
      • engineered mutation (154-155)
      • engineered mutation (186)
    Domains in SCOPe 2.06: d5oqaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oqaA (A:)
    msaikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fxnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfyg
    tnfpangpvmqkktlkwepstekmyvrdgvltgdvemalllegnahyrcdfrttykakek
    gvklpgahfvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oqaA (A:)
    saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    xnrvfakypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfygt
    nfpangpvmqkktlkwepstekmyvrdgvltgdvemalllegnahyrcdfrttykakekg
    vklpgahfvdhcieilshdkdynkvklyehavahsg