PDB entry 5oq0

View 5oq0 on RCSB PDB site
Description: Crystal structure of transthyretin mutant 87-110-117
Class: transport protein
Keywords: Amyloidosis, homo-tetramer, retinol-binding protein, TTR, TRANSPORT PROTEIN
Deposited on 2017-08-10, released 2017-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-12-27, with a file datestamp of 2017-12-22.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (86)
      • engineered mutation (109)
      • engineered mutation (116)
    Domains in SCOPe 2.08: d5oq0a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oq0A (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispmhehaevvftandsgprrytiaamlspysyetta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oq0A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispmhehaevvftandsgprrytiaamlspysyettavvtnp