PDB entry 5opd

View 5opd on RCSB PDB site
Description: Structure of phosphorylated EF-Tu in complex with GTP
Class: translation
Keywords: protein-nucelotide complex, TRANSLATION
Deposited on 2017-08-09, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli O9:H4 (strain HS) [TaxId:331112]
    Gene: tuf1, EcHS_A3535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5opda1, d5opda2, d5opda3
  • Chain 'B':
    Compound: Elongation factor Tu 1
    Species: Escherichia coli O9:H4 (strain HS) [TaxId:331112]
    Gene: tuf1, EcHS_A3535
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5opdb1, d5opdb2, d5opdb3
  • Heterogens: GTP, IOD, MG, NA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5opdA (A:)
    mskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvlghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5opdA (A:)
    phvnvgtighvdhgkttltaaittvlaktyggarafdqidnapeitintshveydtptrh
    yahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivfln
    kcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfl
    dsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstc
    tgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesevyilskde
    ggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglrfa
    ireggrtvgagvvakvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5opdB (B:)
    mskekfertkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekarg
    itintshveydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehi
    llgrqvgvpyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkale
    gdaeweakilelagfldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvg
    eeveivgiketqkstctgvemfrklldegragenvgvllrgikreeiergqvlakpgtik
    phtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmv
    vtlihpiamddglrfaireggrtvgagvvakvlghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5opdB (B:)
    ertkvnvgtighvdhgkttltaaittvlaktyggaarfdqidnapeitintshveydtpt
    rhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivf
    lnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelag
    fldsyipeperaidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqks
    tctgvemfrklldegragenvgvllrgikreeiergqvlakpgtikphtkfesevyilsk
    deggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdnikmvvtlihpiamddglr
    faireggrtvgagvvakvl