PDB entry 5op8

View 5op8 on RCSB PDB site
Description: Factor Inhibiting HIF (FIH) in complex with zinc and Molidustat
Class: oxidoreductase
Keywords: on-heme, dioxygenase, oxygenase, DNA-binding, metal-binding, transcription, helix-loop-helix-beta, dsbh, facial triad, asparaginyl/aspartyl hydroxylase, epigenetic regulation, signaling, ard, beta-hydroxylation, activator-inhibitor, oxidoreductase-peptide complex, oxidoreductase
Deposited on 2017-08-09, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: HIF1AN, FIH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5op8a_
  • Heterogens: ZN, A1H, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5op8A (A:)
    smaataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeeliene
    epvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsn
    reemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgw
    gqltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrq
    sqvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykg
    aptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5op8A (A:)
    epreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvypal
    kwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefveklqd
    iqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnllligmegn
    vtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyerfpn
    fqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplkahq
    kvaimrniekmlgealgnpqevgpllntmikgryn