PDB entry 5op5

View 5op5 on RCSB PDB site
Description: Structure of CHK1 10-pt. mutant complex with pyrrolopyrimidine LRRK2 inhibitor
Class: transferase
Keywords: Parkinson's disease, Leucine-rich repeat kinase 2, LRRK2, Checkpoint kinase 1, CHK1, mutant, surrogate, kinase inhibitor, TRANSFERASE
Deposited on 2017-08-09, released 2017-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14757
      • engineered mutation (58)
      • engineered mutation (67)
      • engineered mutation (83)
      • engineered mutation (85-86)
      • engineered mutation (90)
      • engineered mutation (133)
      • engineered mutation (146)
      • engineered mutation (148-149)
    Domains in SCOPe 2.07: d5op5a_
  • Heterogens: 3FE, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5op5A (A:)
    mavpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicilk
    mlnhenvikfyghrregniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvy
    lhgigithrdikphnlllderdnlkiadyslatvfrynnrerllnkmcgtlpyvapellk
    rrefhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsapla
    llhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsghhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5op5A (A:)
    pfvedwdlvqtlgegaygevqlavnrvteeavavkivdmnikkeicilkmlnhenvikfy
    ghrregniqylfmelasggslfdriepdigmpepdaqrffhqlmagvvylhgigithrdi
    kphnlllderdnlkiadyslatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdv
    wscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenps
    aritipdikkdrwynkplk