PDB entry 5ook

View 5ook on RCSB PDB site
Description: Structure of A. marina Phycocyanin contains overlapping isoforms
Class: photosynthesis
Keywords: Models, Phycobilisome, Phycocyanin, A. marina, PHOTOSYNTHESIS
Deposited on 2017-08-08, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycocyanin, alpha subunit
    Species: Acaryochloris marina [TaxId:155978]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ooka_
  • Chain 'B':
    Compound: Phycocyanin, beta subunit
    Species: Acaryochloris marina [TaxId:155978]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ookb_
  • Heterogens: CYC, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ookA (A:)
    mqtplieavssadsqgrflsstelqvafgrfrqaaasldaaktlnskadsladgaanavy
    qkfpyttqmtgsnyastpegkakcvrdigyylriisycliaggtgplddylinglaeinr
    tfdlspswyvealkhikanhglsgdsaveansyidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ookB (B:)
    mldaftkvvsqadtrgayvsdaevdalkamvadankridavnritgnastivanaaralf
    adqpqlcapggnaytsrrmaaclrdmeiilryvtyavytgdasvlndrclnglretysal
    gvpggsvaagvqkmkeaaieiandpkgitqgdcsnlmaeigsyfdlassavg