PDB entry 5onw

View 5onw on RCSB PDB site
Description: X-Ray crystal structure of a nucleosome core particle with its DNA site-specifically crosslinked to the histone octamer and the two H2A/H2B dimers crosslinked via H2A N38C
Class: DNA binding protein
Keywords: Nucleosome Core Particle, Histones, Disulfide, Convertible Nucleotide, DNA, DNA binding protein
Deposited on 2017-08-04, released 2017-11-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • engineered mutation (39)
      • conflict (101)
      • engineered mutation (109)
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5onwb_
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: hist1h2aj, LOC494591
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6AZJ8
      • engineered mutation (37)
    Domains in SCOPe 2.06: d5onwc_
  • Chain 'D':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02281
      • conflict (28)
    Domains in SCOPe 2.06: d5onwd_
  • Chain 'E':
    Compound: Histone H3.2
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84233
      • engineered mutation (39)
      • conflict (101)
      • engineered mutation (109)
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5onwf_
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: hist1h2aj, LOC494591
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6AZJ8
      • engineered mutation (37)
    Domains in SCOPe 2.06: d5onwg_
  • Chain 'H':
    Compound: Histone H2B 1.1
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5onwh_
  • Chain 'I':
    Compound: DNA (147-mer)
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: DNA (147-mer)
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: MN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5onwB (B:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onwB (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5onwC (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgcyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onwC (C:)
    ktrssraglqfpvgrvhrllrkgcyaervgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5onwD (D:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onwD (D:)
    rrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrst
    itsreiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5onwF (F:)
    msgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlk
    vflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onwF (F:)
    rhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyteha
    krktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5onwG (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgcyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkkt
    essksaksk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onwG (G:)
    aktrssraglqfpvgrvhrllrkgcyaervgagapvylaavleyltaeilelagnaardn
    kktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5onwH (H:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onwH (H:)
    rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
    eiqtavrlllpgelakhavsegtkavtkytsa
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.