PDB entry 5onf

View 5onf on RCSB PDB site
Description: The ENTH domain from epsin-1
Class: endocytosis
Keywords: adaptor protein complex, ENDOCYTOSIS
Deposited on 2017-08-03, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epsin-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ENT1, YDL161W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5onfa_
  • Chain 'B':
    Compound: Epsin-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ENT1, YDL161W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5onfb_
  • Chain 'C':
    Compound: Epsin-1
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: ENT1, YDL161W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5onfc_
  • Heterogens: MPD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5onfA (A:)
    mskqfvrsaknlvkgysstqvlvrnatsndnhqvskdslielaeksydsadffeimdmld
    krlndkgkywrhiakaltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgq
    ivrvkakeltallsdderlneernmnikgrnrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onfA (A:)
    mskqfvrsaknlvkgysstqvlvrnatsndnhqvskdslielaeksydsadffeimdmld
    krlndkgkywrhiakaltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgq
    ivrvkakeltallsdderlneernmni
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5onfB (B:)
    mskqfvrsaknlvkgysstqvlvrnatsndnhqvskdslielaeksydsadffeimdmld
    krlndkgkywrhiakaltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgq
    ivrvkakeltallsdderlneernmnikgrnrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onfB (B:)
    mskqfvrsaknlvkgysstqvlvrnatsndnhqvskdslielaeksydsadffeimdmld
    krlndkgkywrhiakaltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgq
    ivrvkakeltallsdderlneernmni
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5onfC (C:)
    mskqfvrsaknlvkgysstqvlvrnatsndnhqvskdslielaeksydsadffeimdmld
    krlndkgkywrhiakaltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgq
    ivrvkakeltallsdderlneernmnikgrnrkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5onfC (C:)
    mskqfvrsaknlvkgysstqvlvrnatsndnhqvskdslielaeksydsadffeimdmld
    krlndkgkywrhiakaltvidylirfgsencvlwcrenlyiiktlkefrheddegidqgq
    ivrvkakeltallsdderlneernmni