PDB entry 5on0

View 5on0 on RCSB PDB site
Description: Crystal structure of NikA in complex with Fe-L2 (N-(2-hydroxy-3methoxybenzyl)-N-N'-ethylenediaminediacetic acid)
Class: metal binding protein
Keywords: artificial oxygenase, CLEC, dioxygen activation, oxidation of carbon-carbon double bonds, METAL BINDING PROTEIN
Deposited on 2017-08-02, released 2017-12-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: nikA, b3476, JW3441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5on0a_
  • Chain 'B':
    Compound: Nickel-binding periplasmic protein
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: nikA, b3476, JW3441
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5on0b_
  • Heterogens: FE, 9YH, ACT, SO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5on0A (A:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5on0A (A:)
    apdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgk
    twtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqit
    lksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrn
    enywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtq
    lsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpya
    nlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiq
    admrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqa
    qqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelg
    nipyapiateipfeqikp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5on0B (B:)
    aapdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedg
    ktwtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqi
    tlksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvr
    nenywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayht
    qlsqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpy
    anlglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeii
    qadmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfq
    aqqgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpel
    gnipyapiateipfeqikpvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5on0B (B:)
    pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
    wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
    ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
    nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
    sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
    lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
    dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpshadfqaq
    qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
    ipyapiateipfeqikpv