PDB entry 5omu

View 5omu on RCSB PDB site
Description: Crystal structure of Amycolatopsis cytochrome P450 GcoA in complex with syringol
Class: oxidoreductase
Keywords: Cytochrome, P450, guaiacol, lignin, CYP255A, Amycolatopsis, heme, haem, oxidoreductase, syringol
Deposited on 2017-08-01, released 2018-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-04, with a file datestamp of 2018-06-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: Amycolatopsis sp. ATCC 39116 [TaxId:385957]
    Gene: AMETH_3834
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5omua_
  • Heterogens: HEM, 3DM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5omuA (A:)
    gpmttterpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcreva
    tspdfeavitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarr
    ylerfendghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsftnaavdeng
    efanpegfaegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiypt
    iyvyllgamqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsatar
    istkpvtiagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacag
    iyfanhvmrialeelfeaipnlerdtregvefwgwgfrgptslhvtwev
    

    Sequence, based on observed residues (ATOM records): (download)
    >5omuA (A:)
    erpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcrevatspdfe
    avitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarrylerfe
    ndghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsftnaavdengefanpe
    gfaegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiyptiyvyll
    gamqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsataristkpv
    tiagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacagiyfanh
    vmrialeelfeaipnlerdtregvefwgwgfrgptslhvtwe