PDB entry 5omp

View 5omp on RCSB PDB site
Description: Human FKBP5 protein
Class: isomerase
Keywords: FKBP51, TPR, isomerase, FK506 binding protein
Deposited on 2017-08-01, released 2017-11-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase FKBP5
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP5, AIG6, FKBP51
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ompa1, d5ompa2, d5ompa3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ompA (A:)
    gplgsmttdegaknneesptatvaeqgeditskkdrgvlkivkrvgngeetpmigdkvyv
    hykgklsngkkfdsshdrnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygs
    agslpkipsnatlffeielldfkgedlfedggiirrtkrkgegysnpnegatveihlegr
    cggrmfdcrdvaftvgegedhdipigidkalekmqreeqcilylgprygfgeagkpkfgi
    epnaeliyevtlksfekakeswemdtkekleqaaivkekgtvyfkggkymqaviqygkiv
    swlemeyglsekeskasesfllaaflnlamcylklreytkaveccdkalgldsanekgly
    rrgeaqllmnefesakgdfekvlevnpqnkaarlqismcqkkakehnerdrriyanmfkk
    faeqdakeeankamgkktsegvtnekgtdsqameeekpeghv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ompA (A:)
    sptatvaeqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd
    rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei
    elldfkgedlfedggiirrtkrkgegysnpnegatveihlegrcggrmfdcrdvaftvge
    gedhdipigidkalekmqreeqcilylgprygfgeagkpkfgiepnaeliyevtlksfek
    akeswemdtkekleqaaivkekgtvyfkggkymqaviqygkivswlemeyglsekeskas
    esfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgeaqllmnefesakg
    dfekvlevnpqnkaarlqismcqkkakehnerdrriyanmfkkfaeqdakee