PDB entry 5oll

View 5oll on RCSB PDB site
Description: Crystal structure of gurmarin, a sweet taste suppressing polypeptide
Class: plant protein
Keywords: Gurmarin, sweet, taste, knottin, GPCR, inhibitor, plant protein
Deposited on 2017-07-28, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-02-20, with a file datestamp of 2019-02-15.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gurmarin
    Species: Gymnema sylvestre [TaxId:4068]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25810 (0-34)
      • conflict (0)
    Domains in SCOPe 2.08: d5olla_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ollA (A:)
    eqcvkkdelcipyyldccepleckkvnwwdhkcig