PDB entry 5olc

View 5olc on RCSB PDB site
Description: Crystal structure of the 3,6-anhydro-D-galactonate cycloisomerase from Zobellia galactanivorans
Class: isomerase
Keywords: cycloisomerase, enolase superfamily, 3, 6-anhydro-D-galactonate, carrageenan, ISOMERASE
Deposited on 2017-07-27, released 2017-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-06, with a file datestamp of 2017-12-01.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olca1, d5olca2, d5olca3
  • Chain 'B':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olcb1, d5olcb2, d5olcb3
  • Chain 'C':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olcc1, d5olcc2, d5olcc3
  • Chain 'D':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olcd1, d5olcd2, d5olcd3
  • Chain 'E':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olce1, d5olce2, d5olce3
  • Chain 'F':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olcf1, d5olcf2, d5olcf3
  • Chain 'G':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olcg1, d5olcg2, d5olcg3
  • Chain 'H':
    Compound: Galactonate dehydratase
    Species: Zobellia galactanivorans [TaxId:63186]
    Gene: dgoD, zobellia_3156
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0L7B8 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.06: d5olch1, d5olch2, d5olch3
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5olcA (A:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcA (A:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5olcB (B:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcB (B:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5olcC (C:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcC (C:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5olcD (D:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcD (D:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5olcE (E:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcE (E:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5olcF (F:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcF (F:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5olcG (G:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcG (G:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5olcH (H:)
    mhhhhhhgskikkiepyvishkldtpfyfsqwqydtrkicivkitlddgtygwgegygpa
    aviksgidfftpfllgkeaighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkl
    lnlpvsvllggvknpiiepyatglyftrtenleellveeallyksqgfkatkmkvglgie
    qdlkyiaairkaigpdmrlmidsnhaycykeaielarkaekfdiswfeepvspedydgyk
    rlrqnttipisggeceylkygfkrlfdkdcvdiaqpdicaaggltevkkiatlaqtynvd
    lvphtwgtwiaisaavhlvanldknpgrmyndlptmeldrtenalrdevtlhkiklengh
    levpctpglgvdvdmdklehyldkeihkdgatkirs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5olcH (H:)
    skikkiepyvishklddtrkicivkitlddgtygwgegygpaaviksgidfftpfllgke
    aighevlwqemyrrsmdyarsgvlqaaisaidvalwdikgkllnlpvsvllggvknpiie
    pyatglyleellveeallyksqgfkatkmkvglgieqdlkyiaairkaigpdmrlmidsn
    haycykeaielarkaekfdiswfeepvspedydgykrlrqnttipisggeceylkygfkr
    lfdkdcvdiaqpdicaaggltevkkiatlaqtynvdlvphtwgtwiaisaavhlvanldl
    ptmeldrtenalrdevtlhkiklenghlevpctpglgvdvdmdklehyldk