PDB entry 5ol4

View 5ol4 on RCSB PDB site
Description: 1.28 A resolution of Sporosarcina pasteurii urease inhibited in the presence of NBPT
Class: hydrolase
Keywords: Urease Nickel NBPT enzyme, HYDROLASE
Deposited on 2017-07-26, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Urease subunit gamma
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ol4a_
  • Chain 'B':
    Compound: urease subunit beta
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ol4b_
  • Chain 'C':
    Compound: urease subunit alpha
    Species: Sporosarcina pasteurii [TaxId:1474]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 9XN, EDO, SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ol4A (A:)
    mhlnpaekeklqiflaselalkrkarglklnypeavaiitsfimegardgktvamlmeeg
    khvltrddvmegvpemiddiqaeatfpdgtklvtvhnpis
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ol4B (B:)
    nyivpgeyrvaegeieinagrekttirvsntgdrpiqvgshihfvevnkellfdraegig
    rrlnipsgtaarfepgeemeveltelggnrevfgisdltngsvdnkelilqrakelgykg
    ve
    

  • Chain 'C':
    No sequence available.