PDB entry 5ol2

View 5ol2 on RCSB PDB site
Description: The electron transferring flavoprotein/butyryl-CoA dehydrogenase complex from Clostridium difficile
Class: flavoprotein
Keywords: Flavin based electron bifurcation, Bioenergetics, electron transferring flavoprotein, acyl-CoA dehydrogenase, FLAVOPROTEIN
Deposited on 2017-07-26, released 2017-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Electron transfer flavoprotein large subunit
    Species: Clostridioides difficile [TaxId:1496]
    Gene: etfA, etfA_4, BN1095_140023, BN1096_550022, BN1097_530021, SAMEA3374989_03962, SAMEA3375004_04103, SAMEA3375059_03747
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Electron transfer flavoprotein small subunit
    Species: Clostridioides difficile [TaxId:1496]
    Gene: etfB, etfB_3, etfB_4, BN1095_140022, BN1096_550021, BN1097_530020, IM33_05895, SAMEA3374973_01501, SAMEA3374989_03963, SAMEA3375004_04104, SAMEA3375059_03748
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ol2b_
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: Clostridioides difficile [TaxId:1496]
    Gene: acdA, bcd, BN1095_140021, BN1096_550020, BN1097_530019, IM33_05890, SAMEA3374973_01502, SAMEA3374989_03964, SAMEA3375004_04105, SAMEA3375059_03749
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ol2c1, d5ol2c2
  • Chain 'D':
    Compound: Electron transfer flavoprotein large subunit
    Species: Clostridioides difficile [TaxId:1496]
    Gene: etfA, etfA_4, BN1095_140023, BN1096_550022, BN1097_530021, SAMEA3374989_03962, SAMEA3375004_04103, SAMEA3375059_03747
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Electron transfer flavoprotein small subunit
    Species: Clostridioides difficile [TaxId:1496]
    Gene: etfB, etfB_3, etfB_4, BN1095_140022, BN1096_550021, BN1097_530020, IM33_05895, SAMEA3374973_01501, SAMEA3374989_03963, SAMEA3375004_04104, SAMEA3375059_03748
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ol2e_
  • Chain 'F':
    Compound: acyl-CoA dehydrogenase
    Species: Clostridioides difficile [TaxId:1496]
    Gene: acdA, bcd, BN1095_140021, BN1096_550020, BN1097_530019, IM33_05890, SAMEA3374973_01502, SAMEA3374989_03964, SAMEA3375004_04105, SAMEA3375059_03749
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ol2f1, d5ol2f2
  • Heterogens: FAD, CA, COS

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ol2B (B:)
    mnivvcikqvpdttevkldpntgtlirdgvpsiinpddkagleeaiklkeemgahvtvit
    mgppqadmalkealamgadrgilltdrafagadtwatssalagalknidfdiiiagrqai
    dgdtaqvgpqiaehlnlpsityaeeiktegeyvlvkrqfedcchdlkvkmpclittlkdm
    ntprymkvgriydafendvvetwtvkdievdpsnlglkgsptsvfksftksvkpagtiyn
    edaktsagiiidklkekyii
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ol2C (C:)
    mdlnskkyqmlkelyvsfaenevkplateldeeerfpyetvekmakagmmgipypkeygg
    eggdtvgyimaveelsrvcgttgvilsahtslgswpiyqygneeqkqkflrplasgeklg
    afgltepnagtdasgqqttavldgdeyilngskifitnaiagdiyvvmamtdkskgnkgi
    safivekgtpgfsfgvkekkmgirgsatselifedcripkenllgkegqgfkiamstldg
    grigiaaqalglaqgaldetvkyvkervqfgrplskfqntqfqladmevkvqaarhlvyq
    aainkdlgkpygveaamaklfaaetamevttkavqlhggygytrdypvermmrdakitei
    yegtsevqrmvisgkllk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ol2E (E:)
    mnivvcikqvpdttevkldpntgtlirdgvpsiinpddkagleeaiklkeemgahvtvit
    mgppqadmalkealamgadrgilltdrafagadtwatssalagalknidfdiiiagrqai
    dgdtaqvgpqiaehlnlpsityaeeiktegeyvlvkrqfedcchdlkvkmpclittlkdm
    ntprymkvgriydafendvvetwtvkdievdpsnlglkgsptsvfksftksvkpagtiyn
    edaktsagiiidklkekyii
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ol2F (F:)
    mdlnskkyqmlkelyvsfaenevkplateldeeerfpyetvekmakagmmgipypkeygg
    eggdtvgyimaveelsrvcgttgvilsahtslgswpiyqygneeqkqkflrplasgeklg
    afgltepnagtdasgqqttavldgdeyilngskifitnaiagdiyvvmamtdkskgnkgi
    safivekgtpgfsfgvkekkmgirgsatselifedcripkenllgkegqgfkiamstldg
    grigiaaqalglaqgaldetvkyvkervqfgrplskfqntqfqladmevkvqaarhlvyq
    aainkdlgkpygveaamaklfaaetamevttkavqlhggygytrdypvermmrdakitei
    yegtsevqrmvisgkllk