PDB entry 5okt

View 5okt on RCSB PDB site
Description: Crystal structure of human Casein Kinase I delta in complex with IWP-2
Class: transferase
Keywords: CK1D, Kinase-inhibitor complex, transferase, Kinase
Deposited on 2017-07-25, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okta_
  • Chain 'B':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oktb_
  • Chain 'C':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oktc_
  • Chain 'D':
    Compound: Casein kinase I isoform delta
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK1D, HCKID
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5oktd_
  • Heterogens: 9XK, SO4, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5oktA (A:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oktA (A:)
    rvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggv
    giptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihskn
    fihrdvkpdnflmglgkkgnlvyiidfglakkyrqhipyrenknltgtaryasinthlgi
    eqsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsef
    atylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5oktB (B:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oktB (B:)
    rvgnryrlgrkigsgsfgdiylgtdiaageevaiklecvktkhpqlhieskiykmmqggv
    giptirwcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihskn
    fihrdvkpdnflmglgkkgnlvyiidfglakkyrhipyrentgtaryasinthlgieqsr
    rddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatyl
    nfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5oktC (C:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oktC (C:)
    rvgnryrlgrkiggsfgdiylgtdiaageevaiklecpqlhieskiykmmqggvgiptir
    wcgaegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdv
    kpdnflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgie
    qsrrddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefa
    tylnfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5oktD (D:)
    mgsshhhhhhssglvprgshmelrvgnryrlgrkigsgsfgdiylgtdiaageevaikle
    cvktkhpqlhieskiykmmqggvgiptirwcgaegdynvmvmellgpsledlfnfcsrkf
    slktvllladqmisrieyihsknfihrdvkpdnflmglgkkgnlvyiidfglakkyrdar
    thqhipyrenknltgtaryasinthlgieqsrrddleslgyvlmyfnlgslpwqglkaat
    krqkyerisekkmstpievlckgypsefatylnfcrslrfddkpdysylrqlfrnlfhrq
    gfsydyvfdwnmlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5oktD (D:)
    lrvgnryrlgrkgdiylgtdiaageevaiklechpqlhieskiykmmqggvgiptirwcg
    aegdynvmvmellgpsledlfnfcsrkfslktvllladqmisrieyihsknfihrdvkpd
    nflmglgkkgnlvyiidfglakkyrdarthqhipyrenknltgtaryasinthlgieqsr
    rddleslgyvlmyfnlgslpwqglkaatkrqkyerisekkmstpievlckgypsefatyl
    nfcrslrfddkpdysylrqlfrnlfhrqgfsydyvfdwnmlk