PDB entry 5okb

View 5okb on RCSB PDB site
Description: High resolution structure of native Gan1D, a putative 6-phospho-beta-galactosidase from Geobacillus stearothermophilus
Class: hydrolase
Keywords: 6-beta-phospho-galactosidase, glycoside hydrolase, GH1, Gan1D, HYDROLASE
Deposited on 2017-07-25, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.33 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okba_
  • Chain 'B':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okbb_
  • Chain 'C':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okbc_
  • Chain 'D':
    Compound: Putative 6-phospho-beta-galactobiosidase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: gan1D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5okbd_
  • Heterogens: IMD, GOL, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5okbA (A:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okbA (A:)
    rhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhr
    yqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtly
    hwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlgl
    hppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlaf
    enaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqt
    ttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglrigl
    rrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyc
    awsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5okbB (B:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okbB (B:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
    rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
    wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5okbC (C:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okbC (C:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwaidpvglriglr
    rianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqraitdgvdvlgyca
    wsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrvietngael
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5okbD (D:)
    mihhhhhhehrhlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtn
    gdvavdhyhryqedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrn
    hgiepivtlyhwdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqni
    fisfgyrlglhppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypy
    dsrpenvlafenaeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakp
    dfmgvnyyqtttvehnppdgvgegvmnttgkkgtstssgipglfktvrnphvdttnwdwa
    idpvglriglrrianryqlpilitenglgefdtlepgdivnddyridylrrhvqeiqrai
    tdgvdvlgycawsftdllswlngyqkrygfvyvnrddesekdlrrikkksfywyqrviet
    ngael
    

    Sequence, based on observed residues (ATOM records): (download)
    >5okbD (D:)
    hlkpfppeflwgaasaayqvegawnedgkglsvwdvfakqpgrtfkgtngdvavdhyhry
    qedvalmaemglkayrfsvswsrvfpdgngavnekgldfydrlieelrnhgiepivtlyh
    wdvpqalmdaygawesrriiddfdryavtlfqrfgdrvkywvtlneqnifisfgyrlglh
    ppgvkdmkrmyeanhianlanakviqsfrhyvpdgkigpsfayspmypydsrpenvlafe
    naeefqnhwwmdvyawgmypqaawnylesqgleptvapgdwellqaakpdfmgvnyyqtt
    tvehnpssgipglfktvrnphvdttnwdwaidpvglriglrrianryqlpilitenglge
    fdtlepgdivnddyridylrrhvqeiqraitdgvdvlgycawsftdllswlngyqkrygf
    vyvnrddesekdlrrikkksfywyqrvietngael