PDB entry 5ok4

View 5ok4 on RCSB PDB site
Description: Crystal structure of native [Fe]-hydrogenase Hmd from Methanothermobacter marburgensis inactivated by O2.
Class: oxidoreductase
Keywords: [Fe]-hydrogenase, Fe-Guanylylpyridinol cofactor, H2, hydrogenase, methanogenesis, methenyl-tetrahydromethanopterin, methylene-tetrahydromethanopterin, hydrogenation, O2, inactivation, OXIDOREDUCTASE
Deposited on 2017-07-25, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.29 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methenyltetrahydromethanopterin hydrogenase
    Species: Methanothermobacter marburgensis str. Marburg [TaxId:79929]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ok4a1, d5ok4a2
  • Heterogens: FE, FEG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ok4A (A:)
    mklailgagcyrthaasgitnfsracevaemvgkpeiamthstitmgaelkelagvdevv
    vadpvfdnqftviddfayedvieahkedpekimpqirekvnevakelpkppegaihfthp
    edlgfeittddreavadadfimtwfpkgdmqpdiinkfiddikpgaivthactipttkfy
    kifeqkhgdlvtkpetlnvtsyhpgavpemkgqvyiaegyasedaietlfelgqkargna
    yrlpaellgpvcdmcsaltaityagilsyrdsvtqvlgapasfaqmmakesleqitalme
    kvgidkmeenldpgallgtadsmnfgasaeilptvfeilekrkk